Protein Info for GFF903 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG138315: Putative alpha helix protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF04751: DarP" amino acids 26 to 176 (151 residues), 190.6 bits, see alignment E=7.9e-61

Best Hits

Swiss-Prot: 100% identical to YJGA_SALDC: UPF0307 protein YjgA (yjgA) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 100% identity to sek:SSPA3935)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>GFF903 FIG138315: Putative alpha helix protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLD
ADLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEH
LRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAE
NEG