Protein Info for GFF902 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13412: HTH_24" amino acids 16 to 62 (47 residues), 55.8 bits, see alignment E=4e-19 PF13404: HTH_AsnC-type" amino acids 16 to 56 (41 residues), 50 bits, see alignment E=3.1e-17 PF01037: AsnC_trans_reg" amino acids 78 to 160 (83 residues), 96.7 bits, see alignment E=9e-32

Best Hits

Swiss-Prot: 36% identical to LRP_ECOL6: Leucine-responsive regulatory protein (lrp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 98% identity to vap:Vapar_2047)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF902 Transcriptional regulator, AsnC family (Variovorax sp. SCN45)
MKINRQIIGDNEGSFDKTDLAILRVLLLDSRKTLQEIGNEVGLSPTSCWTRIKKLEATGV
IKRYTVDVDPAKLGYHDSVIVQVTLESHTDETLYDFGRVLATIPEIQEAYLVSGDYDYYI
RIAVRDTRDYERLLREKLYKIPGIRHSKSHFVLRVLKETSVPVI