Protein Info for GFF900 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 140 to 157 (18 residues), see Phobius details PF13380: CoA_binding_2" amino acids 21 to 146 (126 residues), 91.5 bits, see alignment E=1.3e-29 PF02629: CoA_binding" amino acids 21 to 109 (89 residues), 31.9 bits, see alignment E=4.5e-11 PF13607: Succ_CoA_lig" amino acids 166 to 303 (138 residues), 131.6 bits, see alignment E=4.3e-42 PF19045: Ligase_CoA_2" amino acids 315 to 466 (152 residues), 32.8 bits, see alignment E=1.8e-11 PF13549: ATP-grasp_5" amino acids 491 to 708 (218 residues), 222.6 bits, see alignment E=1e-69

Best Hits

KEGG orthology group: None (inferred from 74% identity to axy:AXYL_06719)

Predicted SEED Role

"Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>GFF900 Acetyl-CoA synthetase (ADP-forming) alpha and beta chains, putative (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPSAQRRLYAPHELHRLIAPRSIAIVGASAKPGSFSNRTLENLAHYQSDIHLVNPRYDEL
AGRPCHASLKALPAAPDCVVIALPWQAALDAVREAADAGAGGAIVYASGFSETGLSERIV
LQDAMADIARDSGLRILGPNCLGIAHVALGAGLLFQMGYAQLPKPPGRVGLVSQSGALGY
ALLQGAHNGMAYTHLLTAGNSCDVDVLDLAHYLVQDPDCRSVACVFEAAGDAERLQALAD
AARERGKPVIVYKTAVGEAAAAAAQSHTGSLAGSSQAFEAAMRRGGFVRAHSLAELTEMA
DFFAKAPAPVAPGVAVMATSGGAAIMCADAGANHGIDLPQPHAEAQAVLDATVPEFGSPH
NPCDITGQVLNSPEAFEACARAMLRDDHYGVLVLPQVTAGQVIADKRCPVVSALAREAGK
PVCIVWLPHWLEGPGAITYMRDERIGFFRDTERCFRTLAAWQDWHRWRDTPRPTHAVGAP
AGAPSPALALLRQQPQVITEQVAKQLVALYGLPVVQERVAASVREVEQQARGMPLPLVLK
YDAPGIAHKTELGLVRVSLASADEVSRAAHQMLASLSEHAPGAGPGRFLLQPMEKGDFEL
VLGMKRDPVFGPLVMVGLGGVLIEMFGDVATELAPVDPSQAAAMLRRLKVYPLLQGYRGN
PGVDLDALADLVARFSRMCMDLCNDVDEIDLNPVMARGNRFVAVDALIVRRPT