Protein Info for GFF898 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 381 (344 residues), 149.3 bits, see alignment E=2.1e-47 PF00083: Sugar_tr" amino acids 83 to 213 (131 residues), 29.9 bits, see alignment E=4.2e-11 PF03137: OATP" amino acids 224 to 326 (103 residues), 32.6 bits, see alignment E=4.3e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF898 hypothetical protein (Sphingobium sp. HT1-2)
MADSDPHFDTASAVTPPEALPSMAYRAYFLLLMVLVSASVQGERYLMVVMVEPIRHELGL
SDAAIGMAKDMIIAIVYILAIIPLARLADGWSKRKIVAIAATVWSAAVIVCGLAKSFWIL
LIGRAGIGLGEGGFTPPSQAWIADLFPIRQRATALSIFLLGASLGTFLGPAVGGWAVQAY
GWRETLIFASIPGFILAPIVWFTLRDSRSGLADGASAEQARPVPFLQTARELLAIRTLPP
LIAAASLNALLTMGFISWAPAFMERTHGMPASQAGLQMGGALFFGSAIGHTLGGPLADYL
GRRDMRWYVWILMLSGACATAIGWMILTGPGDRVFPLYGLNMLLGGLSAAPLMAVVAGLV
PSRSRATAIAVLMVSIQVVGLGGGPVLVGALSDALRPVYGEDSLGMAMRWALLVGIPSTI
LAWFASRSCRKDFAAAGGWDRSTMPAAIH