Protein Info for GFF897 in Xanthobacter sp. DMC5

Annotation: Urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 8 to 200 (193 residues), 330.7 bits, E=1.6e-103
• PF02492: cobW
  • amino acids 10 to 179 (170 residues), 133 bits, E=4.7e-43

Best Hits

Swiss-Prot: 83% identical to UREG1_METRJ: Urease accessory protein UreG 1 (ureG1) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K03189, urease accessory protein (inferred from 92% identity to xau:Xaut_4160)

MetaCyc: 66% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Protein Sequence (207 amino acids)

>GFF897 Urease accessory protein UreG (Xanthobacter sp. DMC5)
MSSGKNPLRVGVGGPVGSGKTALMEALCKAFRERYDLCAITNDIYTKEDARLLTVAGALP
PERILGVETGGCPHTAIREDASINLRAVADMNARFPNLDLVLIESGGDNLAATFSPELAD
ITIYVIDVAGGEKIPRKGGPGITRSDLLVVNKTDLAPMVGADLAVMEADTIRMRAGRPYV
FSSIRNGVGVEVVAAFIEKAGGLAGAA