Protein Info for GFF897 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 258 to 416 (159 residues), 140.8 bits, see alignment E=1.7e-45 PF00990: GGDEF" amino acids 258 to 413 (156 residues), 152.5 bits, see alignment E=8.6e-49 PF00563: EAL" amino acids 434 to 667 (234 residues), 231.4 bits, see alignment E=1e-72

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (690 amino acids)

>GFF897 hypothetical protein (Methylophilus sp. DMC18)
MITTQMLLVALFTSSVVGCFFAFKLVDRLRVATPKEHDFMLKKYAVVMAAGIFSLHAGYQ
FLADNIPKVSQHPIDLIGCMLCSYLLAAAILKTVHKKRLPLRDLLSASAATGISGYLLSY
FYQISAGAINIRIDSWTALFSLFLACLTAALAIVTILWLKGYSGKLEKRLKWMFSIEIAL
GFLASHTAINLSIVHNNMLIGQPSDQADNYLMLLLVLVPVFLFITSFILVIFYERNIDLA
QSKLTFRNTQTVNKKFLAYDPLTHLPNRDALNQHLILSAKRCDRNGESLALAYIDLDHFK
PVNDQFGHHIGDLLLIEVSKRISNAIRNCDYVARAGGDEFIAVLSEIENHQSVVTVIQRV
VDALRETFVIEDHVIEISCSVGVSMYPQDGNLQKLKLNADAAMYKAKENGKNQYRFFDAE
IEQASDEMQQTRIELKQAISEQEFRLLFQPKVDAITRMVHGAEALLRWQHPARGLLSPNS
FIEAAERFGMIEEINAWVISQACRTISQARDRGIDLSISVNMSNQQFRNKQLGALIQSIL
EAHAVESRNLILEVSETNAIHHQGQFKDTLRQFKQQGLKISLDDFGLHPFSLTHLEDLEV
SEVKLDRSLTKNVAVSHTSLSIVEAIVKLAHALNLNVVAEGVEDEEQRKALVNIGCDQMQ
GFLFSKPVEQQYLFDVFSKLQSQSATQNLF