Protein Info for GFF896 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Response regulator of zinc sigma-54-dependent two-component system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 64 to 82 (19 residues), see Phobius details PF00158: Sigma54_activat" amino acids 250 to 417 (168 residues), 202.2 bits, see alignment E=1.5e-63 PF14532: Sigma54_activ_2" amino acids 251 to 422 (172 residues), 75.3 bits, see alignment E=1.7e-24 PF07728: AAA_5" amino acids 273 to 395 (123 residues), 31 bits, see alignment E=7e-11 PF07724: AAA_2" amino acids 274 to 386 (113 residues), 34.1 bits, see alignment E=8.3e-12 PF02954: HTH_8" amino acids 528 to 555 (28 residues), 30.6 bits, see alignment (E = 6.6e-11)

Best Hits

KEGG orthology group: None (inferred from 73% identity to axy:AXYL_06723)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>GFF896 Response regulator of zinc sigma-54-dependent two-component system (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSRMNASMNSVSHEDIASARESVGIWMRDLETGQEQLHGTACLASIRRQVLPELEKWLQR
GLDAGLFATEGATPLIVVVWLVDSAQVMLIKPAGEDDALMRFIATVPFAAPVLNHILTSP
HDAISVVDCGGIMRYISPTHERWLGLRSGEAVGRPAHQIIPNSRMAEVAASGVAEIGQPY
SADGVATRIVSRIPIRVGGAVVGVVGRTLFKGPEVVQRMYREVSRLQNEVTRYQRTLGVM
APEPESLGRLVGNSAPMLDLKKEIRVVAELDVPVLILGESGVGKELVAQALHDLSPRRKQ
QMVSLNLAALPASLLEAELFGYAPGSFTGSHKQGRIGKFELADKSTVFLDEIGDISADIQ
VKLLRVLEDYTVERLGEHRSRKVDFRLVAATHRKMDDLVALGQFRLDLFYRLAGVTLHVP
GLSERLEDIPELLTHFIQQFCARNRWEVPEVHPEVAPFLAQQAWPGNVRQLRQRIEEALV
FSARQTLERRHFERHGASRQPRVHAPALAMAVPLENPLTMTQHMQKAVREAVEAHGGNKQ
RAARALGISRSHLYRLLGG