Protein Info for GFF895 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF01548: DEDD_Tnp_IS110" amino acids 5 to 142 (138 residues), 48.8 bits, see alignment E=7.1e-17 PF02371: Transposase_20" amino acids 210 to 289 (80 residues), 74.7 bits, see alignment E=6.5e-25

Best Hits

Swiss-Prot: 48% identical to TPF20_PSEAE: Probable family 20 transposase (PA0445) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 55% identity to afe:Lferr_2781)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF895 Mobile element protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLAVIGLDIAKRFFQLHSVDPDTGEITKLKLKRAEMVPFFSNRQPCVVAMEACGSSHHWA
RQLRALGHEVRLIATKFVKPFVKGNKNDAADARAIWEAAQRPEMRFVPVKTEAQQAILAL
HTMRDGLVKARTAQLHQLRAVFYELGFALPEGRHWCVKRLPEAFASLEDKIPAMAIEAMR
DQYQLILQLSERVDAIERKLEAFKRSDERCERLLQIPGVGLLTATSIVASVGDAKEFSSG
REFAAWLGVVPRHTGTGGRVRILGMSKQGNSYLRTMLIHCSRAVMARQKEHSPWLERLMR
DRPWNVAVVALANKIARTIWAMLAHSRNYKPEIQQSAA