Protein Info for GFF894 in Sphingobium sp. HT1-2

Annotation: oxidoreductase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 3 to 111 (109 residues), 44.3 bits, see alignment E=4.1e-15 PF22725: GFO_IDH_MocA_C3" amino acids 131 to 264 (134 residues), 65.8 bits, see alignment E=5.6e-22 PF02894: GFO_IDH_MocA_C" amino acids 134 to 362 (229 residues), 47 bits, see alignment E=4.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>GFF894 oxidoreductase domain protein (Sphingobium sp. HT1-2)
MVLRVGIVSAAWGAFAHLPAWRAIPGVEVTAICTSREETARAAQQRLGLPRAFWNAEEMC
ADPDIDIVDLGTRPSVRLPMVLAALAHGKHIYNASPHAPDLAGAKAIDTAWRGGGSIGVV
DAFSQYLPALRQMKAMLDDGHIGAPLGGTCHFNISLFNQPNKLFPYNWFAQAGQGVSAVR
NNGSHALYLLLHLLGPIAELVADDSQILKRWTFPDGDTITPETTDLANVILRFESGLVLQ
MQISWSMALHDGFLLDLFGDKGRMVSTSPTFPTARDCTLRAGQLGGTLEDVALPDAFKTT
PGIALDWQSEPQPSYPMALSMQAMVDAIYERGTAAPDFARALEVERIQKAIRISSAERRW
VRVADII