Protein Info for GFF894 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05598: DUF772" amino acids 1 to 86 (86 residues), 70.6 bits, see alignment E=1.3e-23 PF01609: DDE_Tnp_1" amino acids 113 to 288 (176 residues), 123.1 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 58% identical to INSH5_ECOLI: Transposase InsH for insertion sequence element IS5Y (insH5) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to del:DelCs14_1761)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF894 Mobile element protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNKIVPWQALVALIQPHARGAHQALGGRPPFAVETMLRIHCLQLWWNLSDPAMEAELHER
PLYRRFVGLDGAARLPDESTILRFRHLLEKHQLAPQVLATINAGLAHQGLLLKTGTVVDA
TIIAAPSSTKNSTGERDPEMHQTKKGNQWHFGMKAHIGVDADSGLVHSVVGTAANVNDVT
QAGALVHGEETDVFADAGYQGVAKREETQGINANWHVAMRPGKRKVLDKSTPMGEIMDKL
EQTKARIRAKVEHPFRVIKQQFGHAKVRYRGLAKNTARLTMLFALSNLWMVRRQILRLQG