Protein Info for GFF894 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01046005: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 245 (229 residues), 60.3 bits, see alignment E=8.3e-21 amino acids 221 to 385 (165 residues), 61.1 bits, see alignment E=4.6e-21

Best Hits

Swiss-Prot: 100% identical to Y4428_SALTY: Uncharacterized MFS-type transporter STM4428 (STM4428) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ecq:ECED1_0307)

Predicted SEED Role

"FIG01046005: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF894 FIG01046005: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPALTQHSTSITLFRISAAMFLNYLTIGIPLVMLPLYVQQQLHLSDLLIGIAVGSQFIAT
LLTRGAAGRKADTSGGRRTVITGQFYCAASGLLMLVSLIAHPVPLLAWAILIVGRVLLGI
GESFILTGNLTWGMWLAGSTHAGQVISWNGMATYGALAIGAPLGLSLYARAGLALPALLV
VLLPIIASGVIYGIPGNIPTARPRVPVLRVVGLVWRPGTGLVLQGIGFATLSAFTALWFN
ERHWDNTGFAMTLFGIAFIAVRFFCAKFPDRYGGATVATFSLLVEGTGLAVMWAAPSAGA
ALIGAAITGCGCSLMFPSLGVEVVRRVPPEIRGTALGVWSAFQDLAYGFTGPIAGLLTPF
IGYQQVFLLAAACALLGAAVVHLLLRQH