Protein Info for GFF890 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 210 to 230 (21 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details PF02518: HATPase_c" amino acids 554 to 643 (90 residues), 39.2 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: None (inferred from 79% identity to vpe:Varpa_3463)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (655 amino acids)

>GFF890 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
MRLGSKGCWRIGWSIAKLWLALLLAILPCAHADESPRNEDTAVHITRAELLSVTGTGYSL
PPQHIEADTLLSDGWKPVDLPYTAARELVPTASSGMRAITDWYRIDLSGQPRTTQQRVLY
LPRWKTLGHISVYGDGVLLYQSHGSPIHNGYNHPLLLPLNATANTLSPTSVLIRVDRLRN
SGSGFSTVWVGDEHALAWRYQSRQLLQVQLPFMGSAAFLAVGAFAFAVWLGKRRESLYLL
FSAISGVAFLRMLHYYVGGSYIPISDEWFEWMTVSSLLWLIVLIHLFLQRLHQQPSAWLT
RVALGLTLACNLATLPHVSTSIVSLYLFTPLLNLAVLPVAVLIFAVNLRKALRAQLPEGR
LVAGWTVFAVVFTSYDGLLQNNLVSPESVYTSPYAIISLFFVFSFIMFQRYTGAFAEVGR
LNTELVLRLRAREAELEQSYQRLRVIENQQMLNAERRRLMQDMHDGLGSSLISAIRSVER
GTMNEAEISSVLKSCMEDLKLVIDSMESVDADLLLLLATLRFRLAPRIESAGVALRWEVQ
PVPVLAWLDPNSALHILRIVQECVANVLRHTRASSICFSTMTVHDGVCVVIEDNGEGFAV
DEALRRNGRGLRNQQQRAQAIGGAVSWESGSAGTRFTLWLPLHREADAARTLDPA