Protein Info for GFF889 in Sphingobium sp. HT1-2

Annotation: Acetoin dehydrogenase E1 component alpha-subunit (EC 2.3.1.190)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00676: E1_dh
  • amino acids 21 to 313 (293 residues), 258.5 bits, E=1e-80
• PF02775: TPP_enzyme_C
  • amino acids 119 to 242 (124 residues), 25.1 bits, E=2.1e-09
• PF13292: DXP_synthase_N
  • amino acids 119 to 184 (66 residues), 26.5 bits, E=5.8e-10

Best Hits

Swiss-Prot: 43% identical to ACOA_BACSU: Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha (acoA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 66% identity to azl:AZL_b01480)

Predicted SEED Role

"Acetoin dehydrogenase E1 component alpha-subunit (EC 1.2.4.-)" in subsystem Acetoin, butanediol metabolism (EC 1.2.4.-)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Lysine degradation
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.-, 1.2.4.1

Use Curated BLAST to search for 1.2.4.- or 1.2.4.1

Protein Sequence (331 amino acids)

>GFF889 Acetoin dehydrogenase E1 component alpha-subunit (EC 2.3.1.190) (Sphingobium sp. HT1-2)
MAELSNAPAPSQEALVDIYRRMIRIERNDDAIRKTIRLGRLVMPYYSARGQEVIPATISS
LLTDDDKICTIYRGIHDMVAKDMPLRPLWAEIAGRVDGTCKGKGGPMHLTHPETGVMVTT
GIVGSSMPIANGLAWAAKLDGSKRVTIAYFGDGASNIGAFHEALNLASVWKLPVIFVCQN
NGFAEHTRYENGTSVDFIAKRAIGYGMPGHSVDGNDPLAMYAAAHEAITRAREGEGPTLL
ECKTFRFLGHVLGDDDKYMTKEEKAAAIAKDPLPAFKAWLVAQGHATEDQLAEMQAKIEA
EVEDAQEFGLASPLPSVDELRRDVFAQEMPA