Protein Info for GFF884 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Major myo-inositol transporter IolT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 345 (17 residues), see Phobius details amino acids 351 to 376 (26 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 423 to 444 (22 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 8 to 454 (447 residues), 361.7 bits, see alignment E=3e-112 PF00083: Sugar_tr" amino acids 17 to 457 (441 residues), 351.1 bits, see alignment E=1e-108 PF07690: MFS_1" amino acids 21 to 397 (377 residues), 128.2 bits, see alignment E=3.7e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to spq:SPAB_05562)

Predicted SEED Role

"Major myo-inositol transporter IolT" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>GFF884 Major myo-inositol transporter IolT (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSTSDSCYNTGYILRICAIAALGGILFGYDTAVISGAIGSLTSYFHLSPAETGWAVSCVV
VGCVIGSFSAGYLSKRFGRKKSLMVSALLFTISAVGTSLSYTFTHFVIYRIIGGLAVGLA
ATVSPMYMSEVSPKNMRGRALSMQQFAIVFGQILIFYVNYKIASIAADTWLIELGWRYMF
AAGIIPCILFCILVFLIPESPRWMMMIGREEETLKILTKISNEEHARHLLADIKTSLQND
QLNAHQKLNYRDGNVRFILILGCMIAMLQQVTGVNVMMYYAPIVLKDVTGSAQEALFQTI
WIGVIQLIGSIIGAMIMDKMGRLSLMRKGTIGSIIGLLLTSWALYSQATGYFALFGMLFF
MIFYALSWGVGAWVLISEIFPNRMRSQGMSISVGFMWMANFLVSQFFPMINENPYLLSHF
HGAFPMWIFAICCIFSYFFICRYLPETKGISLEKMESVVLAKRRKKLQPIQTERYSD