Protein Info for GFF88 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 57 to 82 (26 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 36 to 446 (411 residues), 435.2 bits, see alignment E=3.6e-134 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 48 to 446 (399 residues), 487.1 bits, see alignment E=7.4e-150 PF13727: CoA_binding_3" amino acids 52 to 220 (169 residues), 83.5 bits, see alignment E=1.8e-27 PF02397: Bac_transf" amino acids 256 to 441 (186 residues), 225.7 bits, see alignment E=3.1e-71

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 62% identity to pol:Bpro_1875)

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>GFF88 capsular polysaccharide biosynthesis protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
LHALEVSLSPLVGVACLWALARTMDGGIHPEYFILGVVVFALTFPGPARLTVSARVLVVD
VLLSWGATLGLLLAAGLVTGYLRAYPADLLMAWAAVVPVVDTLGWLALRRAAPALVRLQG
PPDRALVVGMNHQGLALAHSLKAAVFNNIDVVGFVDDRSRERLQTDAPFTLLGRFDRLAE
VINSQRISLIYISLPMASQPRILKILDDLKDTTASIYFVPDMFVTDLIQSKPTLLCGMPV
ISVCDTPFQGLNGLLKRGSDIVLASVILLGLAPVMLAIALAVKFGSPGPVIFKQRRYGQE
GEEIVVYKFRSMTVAEDGPNIQQARRDDKRITPLGAFLRKTSLDELPQFINVLQGRMSIV
GPRPHAVAHNELYRKLIKGYMVRHKVKPGITGWAQVNGYRGETDTLEKMEGRIEYDLDYL
RNWSLKLDLLIVLKTVRLVFKDQQAY