Protein Info for GFF879 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Electron transfer flavoprotein, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF01012: ETF" amino acids 31 to 206 (176 residues), 132.5 bits, see alignment E=7.9e-43

Best Hits

Swiss-Prot: 64% identical to ETFB_PSEAE: Electron transfer flavoprotein subunit beta (etfB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 82% identity to adk:Alide2_1853)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF879 Electron transfer flavoprotein, beta subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
VKILVAVKRVLDYNVKARVKSDGSGVDLANQKLSMNPFDEIACEEAVRLREAGVASEVIV
VSCGPAACQETLRSAMAIGADRAVLVETDAALEPLAVAKLMQHVAQKEGVQFAIFGKQAI
DDDAGQTGQMFGALMGWAQASFASKVQISGDTATITREIDGGLETLAMKLPAVITTDLRL
NEPRFITLPNIMKAKKKPMEVIKAAELGIDIAPRTVTLNVSEPPTRKAGIKVADPAELVK
RLKEEAKVI