Protein Info for GFF876 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 289 to 318 (30 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details PF14351: DUF4401" amino acids 30 to 370 (341 residues), 127.4 bits, see alignment E=7.9e-41 PF14345: GDYXXLXY" amino acids 405 to 544 (140 residues), 96.5 bits, see alignment E=1.4e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>GFF876 hypothetical protein (Variovorax sp. SCN45)
MIAPSEIIRRASAQGLLPNDAQWPRDEARPWPVLLLTALGAWLAVLPLLGAVGLAFGDAL
LREGPALYVFGLGLLAVSVVILRQRGVPLFIEQLCLPATVLGLCCLGWALFRDLTVSIAA
LGMCVASVVLAALTPLHWLRTLLGMMLGLFLTIAAMGWSSGENAFDHLFLSGRFRWTWWL
QAHLGLAIWLAVLGLLPRLPGARAGSLLSSLADGWCAQLLLMLVLLSGATFMLGGMVPGS
DIGHEMGQAGGSLDLLGNTRNLVSVSCALAAAALLAYRWPALRRMPLAGLGVALLLAVLC
AFMPNLGATCLCTAALAVTQRWRLAALGCAAALWIVGSFYYLLAWSLADKALLLVLVGAA
LGALAWLATRAMSPATDATTAAAAAGSWWKNRRLAGIALAGIATLAVANFAIFEKEHIIR
DGRPVFVRLAPVDPRSLMQGDYMQLNFALPDRWSLADRPRGGQRPTVLVRPDPNLLSAYT
LHLPSALEPRQDNDLEVPLSAKDGNWVFVTDAWFFKEGDAHKFEGARYGEFRILPNGSAL
LVGMADEQLQPIR