Protein Info for GFF858 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 158 (141 residues), 62.1 bits, see alignment E=3.5e-21 amino acids 171 to 304 (134 residues), 59.6 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to seg:SG4237)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>GFF858 Permease of the drug/metabolite transporter (DMT) superfamily (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDTQRQASPFARKNVVYVCAAFCCLLWGSAYPAIKSGYDLFQIATDDIPSKIVFAGYRFL
FAGGLLLLFALLQRKPIGRFRPRQFAQLTLLGLTQTSLQYLFFYIGLAFTSGVKGSIMNA
TGTFFSVLLAHFIYQNDRLSYNKTLGCILGFAGVMVVNVSNGLDFSFNLPGEGSVVLAAF
ILSAATLYGKRLSQTVDPMVMTGYQLGIGGLVLVIGGYVFGGTLTIHGFSSVAILVYLTL
LSSVAFALWSILLKYNRVGMIAPFNFLIPVSGAALSAIFLGENILEWKYMIALVLVCSGI
WWVNKVKR