Protein Info for GFF852 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-ribulose-5-phosphate 4-epimerase UlaF (EC 5.1.3.4) (L-ascorbate utilization protein F)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00596: Aldolase_II" amino acids 6 to 193 (188 residues), 183.1 bits, see alignment E=2.5e-58

Best Hits

Swiss-Prot: 100% identical to ULAF_SALPB: L-ribulose-5-phosphate 4-epimerase UlaF (ulaF) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K03077, L-ribulose-5-phosphate 4-epimerase [EC: 5.1.3.4] (inferred from 98% identity to sew:SeSA_A4656)

MetaCyc: 92% identical to L-ribulose-5-phosphate 4-epimerase UlaF (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 4-epimerase. [EC: 5.1.3.4]

Predicted SEED Role

"L-ribulose-5-phosphate 4-epimerase UlaF (EC 5.1.3.4) (L-ascorbate utilization protein F)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 5.1.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.4

Use Curated BLAST to search for 5.1.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF852 L-ribulose-5-phosphate 4-epimerase UlaF (EC 5.1.3.4) (L-ascorbate utilization protein F) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQKLKQQVFDANMDLPRYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKVDDMVVVDM
DGKVVEGRYRPSSDTATHLALYQRYPSLGGVVHTHSTHATAWAQAGMAIPALGTTHADYF
FGDIPCTRALSEEEVQGEYELNTGKVIIETLGEVEPLHTPGIVVYQHGPFAWGKDAHDAV
HNAVVMEEVARMAWIARGINPALNPIDDYLMNKHFMRKHGPNAYYGQK