Protein Info for GFF851 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF13188: PAS_8" amino acids 15 to 66 (52 residues), 23.4 bits, see alignment 1.5e-08 TIGR00229: PAS domain S-box protein" amino acids 15 to 132 (118 residues), 79.7 bits, see alignment E=1e-26 PF00989: PAS" amino acids 16 to 121 (106 residues), 43.3 bits, see alignment E=1.2e-14 PF08448: PAS_4" amino acids 20 to 127 (108 residues), 37.7 bits, see alignment E=7.3e-13 PF13426: PAS_9" amino acids 25 to 124 (100 residues), 32.7 bits, see alignment E=2.7e-11 PF08447: PAS_3" amino acids 35 to 114 (80 residues), 36.8 bits, see alignment E=1.3e-12 PF07730: HisKA_3" amino acids 154 to 218 (65 residues), 35.9 bits, see alignment E=3.1e-12 PF02518: HATPase_c" amino acids 259 to 347 (89 residues), 49.7 bits, see alignment E=1.6e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>GFF851 Two-component system sensor histidine kinase (Variovorax sp. SCN45)
VTDLERDNSLPDMPFHTIVEQMVAGIYVIQDDCFVYCNATWAAIAGYTVQEATGMSLAQI
VPPDFLEVVRSRIRARLAEQPPSMHFITRGLHRDGSVRLVEVHGTRITYRGRPAVMGVGV
DVTDRVRNEEELKRSREQLQALAAYTANKLEEQRLAMARDVHDVLGGMLTSIKMDATRIQ
RRAENPEMQSLTRDLIALTQQTIDTVKQISEALRPSALDHLDLSVALANELHAFTRRSGV
PHALDTGTATPRLLPRHTTAVYRIFQEGLTNVSRHSKASHVGVTLRVEGAQLVLELHDDG
CGFDTRTPGGSALGLLSMRERAREIGGELRIESAPGRGTRLALRAPLL