Protein Info for GFF849 in Xanthobacter sp. DMC5

Annotation: Sensory histidine kinase/phosphatase NtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF00989: PAS" amino acids 58 to 161 (104 residues), 37.8 bits, see alignment E=2.7e-13 PF00512: HisKA" amino acids 185 to 242 (58 residues), 53.3 bits, see alignment E=3.5e-18 PF02518: HATPase_c" amino acids 289 to 407 (119 residues), 71.2 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 77% identical to NTRB_BRASR: Sensory histidine kinase/phosphatase NtrB (ntrB) from Bradyrhizobium sp. (strain RP501 Parasponia)

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 93% identity to xau:Xaut_4400)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF849 Sensory histidine kinase/phosphatase NtrB (Xanthobacter sp. DMC5)
MTAEARKQDTRKMDQKRKGSSNPRKDAPKDAPKAAGKEVTPDVAKADVAKAGGAEPGMTR
AILDAVPHPLFTIAGNGHVVEANVAAEAFFEVSAPLLRRRPLTEFVPFGTPLLGLIDQVR
QRGAPVNEYRVDLGTPRNGGERIVDIHVAPVNEQPDNVVVMLQERTIADKMDRQLTHRGA
ARSVSALASMLAHEIKNPLSGIRGAAQLLEQSADDEDRALTRLICDEADRIVKLVDRMEV
FSDERPVEREPVNIHAVLEHVRTLASSGFARHIRFVEEYDPSLPPVLANRDQLIQVFLNL
VKNAAEAIDSDQDGEIQLTTAFRPGVRLMVPGASTRVSLPLEFCVRDNGKGVPEDLVPHL
FDPFVTTKPTGSGLGLALVAKIIGDHGGIVECDSQPRRTTFRVLLPMYRGKSPVREDN