Protein Info for GFF848 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details PF13347: MFS_2" amino acids 13 to 429 (417 residues), 165.8 bits, see alignment E=1.3e-52 PF07690: MFS_1" amino acids 30 to 348 (319 residues), 39.5 bits, see alignment E=3.5e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>GFF848 hypothetical protein (Sphingobium sp. HT1-2)
VIWTRDDGRMLAYASGNFGKALVFSGADLTILFLLSDVLNLGATTAGWLMLAALCGDLIF
DLLAARLTIRLRHVGKGYRWMVAVAATPCAIAFALLYAMPLLGARQLWMLAMALLIFRGA
YAIIDVPHNALMAQVTSDSSARGRVSGYRLLFSTASALIVATLLTPLVQDAGNTRSFDRL
ALTGAATGAVFALTMILCAWTCGGEPSGGAARTARQSARQDGIDIPFRDPMVGALALLAL
LTGFAAPAFGRSLLYIGSYVVRRPDLVATLLLAVTIGQFAGVILWTAMTRRFSKSALLAM
GHGVSIIGLAGFAACLSWPPALAICAAVIGVGLASMFMLPWGLLADAVDVVEWRHGRRFE
TGLFAFYLVVVKASGAAFSSLTGWTLGLLGYVPGQAQTAAVQAGMLGLGLGVPVLGSLCA
ILLMRRFDLGHARHARLLAALAWREERDQSGADPVSGLKRGLEKSSGAGTTLAGGLALSA
QARQSMSRSMAAPAAVRS