Protein Info for PS417_04285 in Pseudomonas simiae WCS417

Annotation: protease TldD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF01523: PmbA_TldD_1st" amino acids 38 to 101 (64 residues), 50.9 bits, see alignment E=2.2e-17 PF19290: PmbA_TldD_2nd" amino acids 127 to 236 (110 residues), 80 bits, see alignment E=2.5e-26 PF19289: PmbA_TldD_3rd" amino acids 244 to 477 (234 residues), 232 bits, see alignment E=7.5e-73

Best Hits

Swiss-Prot: 65% identical to TLDD_ECOL6: Metalloprotease TldD (tldD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to pfs:PFLU0870)

MetaCyc: 65% identical to metalloprotease subunit TldD (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4Q3 at UniProt or InterPro

Protein Sequence (480 amino acids)

>PS417_04285 protease TldD (Pseudomonas simiae WCS417)
MSELLSSVSDHLLAPGGVTIESLQTVLGDLAGPGIDAADLYFQGQISESWALEDGIVKEG
SFNLDQGVGVRAQSGEKTGFAYSNAITLEALGLAARAARSISRAGQNGTVQAFSTQDVAQ
LYAPDNPLEVISRAEKVELLKRIDAATRALDPRIQQVTVSMAGVWERILVASTDGGLAAD
VRPLVRFNVSVIVEQNGRRERGGHGGGGRTDYRYFLTDDRAMGYAREALRQALVNLEAIP
APAGTLPVVLGSGWSGVLLHEAVGHGLEGDFNRKGSSAYSGRMGEMVASKLCTIVDDGTL
AGRRGSLSVDDEGTPTECTTLIENGVLKGYMQDKLNARLMGVARTGNGRRESYAHLPMPR
MTNTYMLGGESDPAEIIASVKRGIYCANLGGGQVDITSGKFVFSTSEAYLIEDGKITAPV
KGATLIGNGPEAMSKVSMVGNDLSLDSGVGTCGKDGQSVPVGVGQPTLKIDAITVGGTGS