Protein Info for GFF84 in Sphingobium sp. HT1-2

Annotation: Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00578: AhpC-TSA" amino acids 37 to 153 (117 residues), 39.2 bits, see alignment E=6.1e-14 PF08534: Redoxin" amino acids 38 to 164 (127 residues), 57.7 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 83% identity to sch:Sphch_0802)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF84 Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase (Sphingobium sp. HT1-2)
MRKLLIWLPLVLFLGFFALFASGLFKPDDRVITSKLIGQALPAFTLPAAASDRPALASTQ
LADGKPRLLNIFASWCIPCAAEAPQLMTLKQAGVEIDAIAIRDARPDVDAFLMRNGNPYS
RIGLDARSGVQIALGSSGVPETFVIDGRGRIAYQHIGDIRADDVPMLLQRLKDAQ