Protein Info for GFF838 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Membrane protein with DUF350 domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details PF03994: DUF350" amino acids 4 to 130 (127 residues), 121.4 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 90% identical to YJFL_ECO57: UPF0719 inner membrane protein YjfL (yjfL) from Escherichia coli O157:H7

KEGG orthology group: K08989, putative membrane protein (inferred from 99% identity to sei:SPC_4521)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>GFF838 Membrane protein with DUF350 domain (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHILDALLAFCAYFFIGAAMVIVFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVI
PLSSAAINSVSIPDYFAWGGIALVIQLLIYGCVRLYMPTLSEKIIHHNVAAGLFMGTAAL
AGGIFNAACMTW