Protein Info for GFF837 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00753: Lactamase_B" amino acids 47 to 239 (193 residues), 39.5 bits, see alignment E=8.9e-14 PF23023: Anti-Pycsar_Apyc1" amino acids 56 to 123 (68 residues), 27.9 bits, see alignment E=3e-10 PF12706: Lactamase_B_2" amino acids 59 to 241 (183 residues), 118.3 bits, see alignment E=5.2e-38

Best Hits

KEGG orthology group: K06167, PhnP protein (inferred from 76% identity to azc:AZC_2264)

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I; PhnP protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF837 hypothetical protein (Xanthobacter sp. DMC5)
MPPSTESATLTFTILGCGSSGGVPRVGQGWGACDPANPRNRRRRCSMLVERIGPNGKTSV
LVDASPDLREQLLGVNVNHLDAVLFTHEHADHTHGIDDLRPLAIHNRKRVEIYADEDTAR
VLHQRFGYCFATPPGSAYPPILNDHRFREGREIVIDGAGGPITALPFRQRHGDIDAFGFR
FDGVAYSSDVNGFPENSLGDLHNLDVWIIDALRETPHPSHFTLQEALDHVALLKPNLAIL
TNLHTDLDYSALAARLPEGVIPAYDGMQFTTDIRSGAALQERTGAAG