Protein Info for PS417_04225 in Pseudomonas simiae WCS417

Annotation: conjugal transfer protein TraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 2 to 298 (297 residues), 242.9 bits, see alignment E=2.2e-76 PF01699: Na_Ca_ex" amino acids 2 to 135 (134 residues), 95.5 bits, see alignment E=1.6e-31 amino acids 160 to 300 (141 residues), 103.3 bits, see alignment E=6.4e-34

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 97% identity to pfs:PFLU0858)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZN6 at UniProt or InterPro

Protein Sequence (348 amino acids)

>PS417_04225 conjugal transfer protein TraR (Pseudomonas simiae WCS417)
MVSGLVLLIIGAEILVRAAVRLAASLKVRPLIIGLTIVAFGSSAPQMTVSLQATLAGNTD
IAVGSVIGSSIFNILVTLGLSALIIPLRVSRQLVRLDIPVMILAGLLVFTLAANEALTPL
DGLVLLVALVAYLGVLHYQTRHSRRPRTLDTVARAPWLSSVLLMLGGLLILVLAGHLLLG
AAVDVAGDLGLSERVIGLTLIGVGTSLPCLATSLIAALRGEREIAVGNVIGSNLFNLLGV
LGLTALLAPSPLSVSPNALDFDLPVMLGVVVLCLPVFYTGYRVTRAEGLVLLGLYLAYGL
HVMAFTTGMPLASKLEQLMLYYVLPVLVAFLLFSTLRAWRRQHKREPQ