Protein Info for PS417_04220 in Pseudomonas simiae WCS417
Annotation: 4-carboxymuconolactone decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to DC4C_ACIAD: 4-carboxymuconolactone decarboxylase (pcaC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 96% identity to pfs:PFLU0857)Predicted SEED Role
"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
- toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
- superpathway of aerobic toluene degradation (12/30 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.44
Use Curated BLAST to search for 4.1.1.44
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U706 at UniProt or InterPro
Protein Sequence (126 amino acids)
>PS417_04220 4-carboxymuconolactone decarboxylase (Pseudomonas simiae WCS417) MTDQKKPGVEMRRQVMGDVFVDRALGNATEFTQPLQDFVNEHAWGSVWNREGLPLKTRSL ITLAALTALKCPQELKGHVRGALNNGCTVEEIREALLHCAVYAGVPAAIDAFRAAQEVIE TYQKEG