Protein Info for PS417_04215 in Pseudomonas simiae WCS417

Annotation: malate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 12 to 302 (291 residues), 67.9 bits, see alignment E=3.1e-23

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 95% identity to pfs:PFLU0856)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUU4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PS417_04215 malate transporter (Pseudomonas simiae WCS417)
MLAIFLTTLTITAPVFAMLFLGVLLKRVNWINDNFIHTASSLVFNVTMPALLFLGILHAD
LHSALKPGLLIYFAVATLLSFALAWGWAIFRCPREDRGIYTQGAFRGNNGVIGLALAASM
YGDYGISLGAILAALVILFYNTLSTIVLAVYSPVIKSDPWSICKSVVANPLIISVIAATP
FAVFQIGLPGWLESSGQSLADMTLPLALICIGGTLSLAALRKSGSMALSASLVKMIGLPV
VATLGAWLLGFRGAELGILFLYFGAPTAAASFVMARAAEGNHELAAAIIVITTLMAAVTT
NIGIFVLQAGGWI