Protein Info for GFF830 in Variovorax sp. SCN45

Annotation: ChlI component of cobalt chelatase involved in B12 biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF20030: bpMoxR" amino acids 34 to 196 (163 residues), 31.3 bits, see alignment E=3.9e-11 PF07728: AAA_5" amino acids 37 to 167 (131 residues), 44.4 bits, see alignment E=5.9e-15 PF00158: Sigma54_activat" amino acids 37 to 143 (107 residues), 27.5 bits, see alignment E=8.5e-10 PF00004: AAA" amino acids 38 to 169 (132 residues), 22 bits, see alignment E=6.7e-08 PF01078: Mg_chelatase" amino acids 84 to 155 (72 residues), 32.4 bits, see alignment E=2.2e-11 PF17863: AAA_lid_2" amino acids 239 to 295 (57 residues), 51.3 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: K03405, magnesium chelatase subunit I [EC: 6.6.1.1] (inferred from 83% identity to vpe:Varpa_3846)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>GFF830 ChlI component of cobalt chelatase involved in B12 biosynthesis (Variovorax sp. SCN45)
MTTAAPMPLPFPFAAIAGQPRLRQALLLAAVDPALGGVLIEGPRGTAKTTAARALAELLP
GAPFVTLPLGASLESLVGTLDLGQALAGHELKFAPGLLARAHGGVLYVDEINLLPDALID
SLLDAAASGVNVVERDGISHRHAARFVLVGTMNPEEGTLRPQLLDRFGLCVQLRNIDDAA
ERQAIVRARLAFDADPAAFRAKHAQAEAELSAALARARARLADASALPYEDAVHDAVGAL
CIEAGVDGLRADLVMLRSARALAAWEGAEAITTDHVRRASEAVLLHRRKPEAAGVPPAQA
PAPAPRGAEANGASQAGSAADEDWGAMPPEPVGIERVKPLRPLIASRPQAAPKKA