Protein Info for GFF83 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF16930: Porin_5" amino acids 39 to 519 (481 residues), 556.5 bits, see alignment E=3.2e-171

Best Hits

KEGG orthology group: None (inferred from 50% identity to tbd:Tbd_0360)

Predicted SEED Role

"Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>GFF83 Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKSPLTHAMRHVSLAALMAVGLVATAHADEREDLETLKQTTLNLIQALVDQGVLPAAKAD
ALVKQAEAKARAAVAEAKKTEQSTVRVQFVPESVRKQIADEVREEVVAQAKMERWGDVNA
VPEWVDRFRLEGDVRLGYQRDMFDEGNAPEIFHQVDGQNVSNTLEDRDRTRLRARLGVSA
RVTQDLTASLRLTTGSSSDPVSTNQTLGNYGSKYNFALDRAFLRSRSQDFLPWLTTTAGR
IPNPFFSTDLVWDDDLAFDGIALQFEDPAAATRTWRPFGTVGWFPLQDIEKSASNQARNK
SLLAAQVGVEWVPSNDLRAKLGLAMYDYRNVSGVRNAFNSNTQDATQPAFRQKGNSLFNL
SNPSSLGGPFGLAADYRVLNLTGTVDYNLFNPVHLILSADYVRNIGFSQSRAQARSGRLL
REEDTGYMVRAAVGMPNMLLRGDWQLSLAYRYLEADAVLDAFTDSDFHLGGTNNKGFIVG
GQYGLSRNTWLSARWLSSREISGLPLSINSFQLYFNAKF