Protein Info for GFF827 in Variovorax sp. SCN45

Annotation: Predicted cobalt transporter CbtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 13 to 27 (15 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details PF01891: CbiM" amino acids 2 to 204 (203 residues), 55.9 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_3849)

Predicted SEED Role

"Predicted cobalt transporter CbtC" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>GFF827 Predicted cobalt transporter CbtC (Variovorax sp. SCN45)
MHIEPGLVDGTKIFLSYATAAAALAYTGKVAIETAVKDGLAALVLRSAIAVALVFCFFEV
LPHHPVGVSEVHLILGTTLLLVFGLAPAAIGLAGGLLIQGLFFEPQDIPQYGMNVTTLLV
PLFATAVLARRIIPKNVAYVDLSYQQAFKLSVAYQGGIVVWVGFWALYGRGTGLENLSQI
ASFGAAYMTVVLVEPLVDLGVLAAAKGWRRLQGSVFVERRLYGGV