Protein Info for GFF827 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: A/G-specific adenine glycosylase (EC 3.2.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR01084: A/G-specific adenine glycosylase" amino acids 19 to 293 (275 residues), 322.7 bits, see alignment E=1.1e-100 PF00730: HhH-GPD" amino acids 49 to 168 (120 residues), 76.2 bits, see alignment E=3.8e-25 PF00633: HHH" amino acids 113 to 141 (29 residues), 28.8 bits, see alignment (E = 1.2e-10) PF14815: NUDIX_4" amino acids 265 to 361 (97 residues), 64.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 56% identity to ctt:CtCNB1_0820)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF827 A/G-specific adenine glycosylase (EC 3.2.2.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSAEAVSVHPLGEVLPITFAPRLIEWQRHSGRSGLPWQNTRDPYRVWLSEVMLQQTQVST
VLSYYPRFLERFPDVRALAAAPPDDVMALWSGLGYYSRARNLHRCAQAVVNDHGGVFPGT
AEQLETLPGIGASTAAAIAAFCHGERISILDGNVRRVLSRLLAFEGDLAQAGPQRELWSL
AQALLPDAPTGDDMTAYTQGLMDLGATVCQRTKPLCGRCPVQTVCRAHGTDQTTRFPVKT
RRVARRFESWWLLLVRGSGADGQPGFWLERRPAPGIWAGLYCPPVFADEAAVQAALPSGF
AQRLQPLEPVSHSLTHRELRLHPLLLDLPGDQTMDSLPGQWVPAAALIDHGLPTPVRQLL
SALS