Protein Info for GFF826 in Sphingobium sp. HT1-2

Annotation: Cobalamin synthase (EC 2.7.8.26)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 174 to 204 (31 residues), see Phobius details PF02654: CobS" amino acids 7 to 229 (223 residues), 158.2 bits, see alignment E=1.6e-50

Best Hits

Swiss-Prot: 59% identical to COBS_NOVAD: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 59% identity to nar:Saro_0326)

Predicted SEED Role

"Cobalamin synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF826 Cobalamin synthase (EC 2.7.8.26) (Sphingobium sp. HT1-2)
MKGLVLAIQFLTRLPMPKVTANETDFARSIRWFPAVGAIVGLSVMFAVNLAVRIDPWIGA
LAGLLCWVGVTGALHLDGLGDIADACGAVHKGRDRLLAVLADPHVGSFGVVAIGLQLIAK
LLLLHALVERGMMLPLLLIPFAARIGPLLWAHMLPPLHAGLGARFADAVKTIHIALWISL
LIIISWWLPVLLAAPLLMLVWGLWLRRRLGGISGDGHGAGIELVESGLLFVVLIANGTT