Protein Info for GFF819 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Epoxyqueuosine (oQ) reductase QueG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00276: epoxyqueuosine reductase" amino acids 19 to 353 (335 residues), 507.9 bits, see alignment E=5.8e-157 PF08331: QueG_DUF1730" amino acids 67 to 145 (79 residues), 83 bits, see alignment E=1.1e-27 PF13484: Fer4_16" amino acids 198 to 261 (64 residues), 78.4 bits, see alignment E=5.8e-26

Best Hits

Swiss-Prot: 100% identical to QUEG_SALTY: Epoxyqueuosine reductase (queG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to sty:STY4712)

MetaCyc: 90% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF819 Epoxyqueuosine (oQ) reductase QueG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLWSIMSKPLDLNQLAQNIKQWGLELGFQQVGITDTDLRASEPALQAWLDKQYHGEMAWM
ARHGMMRARPHELLPGTLRVISVRMNYLPANAAFASTLKDPTLGYVSRYALGRDYHKLLR
SRLKKLGEQIQQYCGSLNFRPFVDSAPILERPLAEKAGLGWTGKHSLILNREAGSFFFLG
ELLIDLPLPVDQPVEEGCGKCVACMTICPTGAIVEPYTVDARRCISYLTIELEGAIPEAF
RPLIGNRIYGCDDCQLICPWNRYSQLTDEADFSPRKALHNPDLLELFSWSEAQFLKVTEG
SAIRRIGHLRWLRNVAVALGNAPWSNAVITALESRKGEHPLLDEHIEWAIAQQIEKRNAC
IIEVQLPKKQRLVRVIEKGLVRDA