Protein Info for GFF818 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphopantetheine adenylyltransferase (EC 2.7.7.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01510: pantetheine-phosphate adenylyltransferase
  • amino acids 14 to 166 (153 residues), 177.5 bits, E=1.9e-56
• TIGR00125: cytidyltransferase-like domain
  • amino acids 14 to 67 (54 residues), 48.5 bits, E=7.7e-17
• PF01467: CTP_transf_like
  • amino acids 16 to 145 (130 residues), 78.4 bits, E=3e-26

Best Hits

Swiss-Prot: 62% identical to COAD_ACIET: Phosphopantetheine adenylyltransferase (coaD) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 74% identity to pol:Bpro_1282)

MetaCyc: 45% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Protein Sequence (172 amino acids)

>GFF818 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSALASTGGSGRVAVYSGTFDPITLGHEDVARRAALLFDDVIIAVAIAHHKKTRFTLQE
RLDMAAEVASRMPGRVRVLPFEGLIMDFCRQHGATAVVRGIRNLTDFDYEAQMAAMNRKL
HAAVETVFLLPQAELQCISSTLVREISQLGGDVSQMVSGAVAARLAPKPLQA