Protein Info for GFF817 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 13 to 199 (187 residues), 140.8 bits, see alignment E=2.1e-45 PF03602: Cons_hypoth95" amino acids 19 to 197 (179 residues), 146.7 bits, see alignment E=3.1e-47

Best Hits

KEGG orthology group: None (inferred from 64% identity to ajs:Ajs_3517)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF817 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKKPASSAARAAASAPHEVRIIGGQWKRTKLPVADRPGLRPTPSRVRETLFNWLGQDLSG
WRCIDAFAGTGALGLEAASRGAVEVVLVEQDSALLANLGRITTQLKATGVRVERGDGVAA
LRQRAGQGLDAVFLDPPFGDGQNEALYAAALAAARQAVRGDGLIYLEAPRVWSEDELAQI
GLQVHRQGKAGAVAFHLLRPLPAQ