Protein Info for GFF815 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG015547: peptidase, M16 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00675: Peptidase_M16" amino acids 57 to 195 (139 residues), 94.2 bits, see alignment E=7.2e-31 PF05193: Peptidase_M16_C" amino acids 204 to 394 (191 residues), 98.7 bits, see alignment E=3.9e-32

Best Hits

KEGG orthology group: None (inferred from 67% identity to pol:Bpro_1279)

Predicted SEED Role

"FIG015547: peptidase, M16 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>GFF815 FIG015547: peptidase, M16 family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRPTRLRCFALLTALAMAGGTAQAQSPSTPPSAAQAPVAQQFTLANGLTLIVRPDRRAPT
VVQMLWVRVGAMDEVDGTTGVAHALEHMMFKGTPDIKAGEFSRRVAAMGGMDNAFTTRDA
TAYHMQIPARRLETAMQLEADRFARNQWDDDEFKREIEVIKEERRQRTEESPRARMFEAL
SAMVYQASPYRRPVIGWMSDIDAMTPDDARAFYRRWYVPANAALVIAGDVDVAQVRALAE
KHFGAIPAATVPARKPREEPAQAGPRRLEYRAVADQALVALAYKVPQWRGAETDNETDRD
ALALTVLSAVLDGYDGARLDRALVQGVGTGGKRLADSAGSSYGLMGRGPQLFMLTAVPSK
GVTTEMAAAALKAEVARIAREGIQETELQRVKTQWTAGEIYKLDSVANQARELGGYWING
MGLDAGERLMARLRGVTAAQVQSVAQRYFSDEQLTTGVLVPDPSRREAAPSAPTGPRPAL
TRH