Protein Info for GFF813 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Undecaprenyl-diphosphatase (EC 3.6.1.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 23 (2 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details PF02673: BacA" amino acids 10 to 266 (257 residues), 274.5 bits, see alignment E=5.2e-86 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 10 to 264 (255 residues), 248 bits, see alignment E=6.1e-78

Best Hits

Swiss-Prot: 70% identical to UPPP2_AGRFC: Undecaprenyl-diphosphatase 2 (uppP2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 70% identity to atu:Atu0998)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF813 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSTSAWLEAAFLGLIQGLTEFLPISSSAHLRIIGPLLPSGGDPGAAFTAITQIGTEAAV
LLYFRHDIVRIFLAWWASLTQPARRQDPDARMGWLIIIGSVPIVVLGLLFKDAIEGSLRN
LYITATMLIVFGIILGAADHYGRRERPLSQLTWGHGLLFGLAQAMALIPGVSRSGGTITA
GLLMGYTREAAARYSFLLAIPAVMGSGFYQLLRSWQHGSPVAPGPTALATLIAFGVGYGV
IVVFLKLVSTRGYMAFVYYRIALGLLVFGLLGAGILSAH