Protein Info for GFF811 in Methylophilus sp. DMC18

Annotation: Fe(2+) transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 217 to 239 (23 residues), see Phobius details amino acids 261 to 273 (13 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 305 to 306 (2 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 354 to 380 (27 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 443 to 464 (22 residues), see Phobius details amino acids 497 to 521 (25 residues), see Phobius details amino acids 540 to 559 (20 residues), see Phobius details amino acids 568 to 588 (21 residues), see Phobius details PF02421: FeoB_N" amino acids 3 to 154 (152 residues), 164.2 bits, see alignment E=3.4e-52 PF01926: MMR_HSR1" amino acids 3 to 114 (112 residues), 75.9 bits, see alignment E=5.4e-25 TIGR00437: ferrous iron transport protein B" amino acids 173 to 562 (390 residues), 377.2 bits, see alignment E=8.5e-117 PF07670: Gate" amino acids 286 to 377 (92 residues), 65.9 bits, see alignment E=8.3e-22 amino acids 446 to 563 (118 residues), 62.2 bits, see alignment E=1.1e-20 PF07664: FeoB_C" amino acids 389 to 438 (50 residues), 55.8 bits, see alignment 6.1e-19

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 72% identity to mei:Msip34_0911)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>GFF811 Fe(2+) transporter FeoB (Methylophilus sp. DMC18)
MKRVALLGMPNTGKSTLFNRLSGASARVGNWPGITVDLMSAKLLLGGHIAELIDLPGLYD
LHGFSDDEHVVRHFLSHHQIDLVLIILNSAQIDRQLSLALQIRALGLPAVLLLNMEDEAK
RAGITINTQAMSKQLGMPVRTISAKYGQGCPEALQLAAETMLQHPNLTSPDSIARKLELE
NAIEQEMHHIIDQSVQFPIQLNHTLTDRLDKVLLHPWFGLPLFLLSVFLLFQFIFSVGAP
LQEGMGWLFDTLRSEALEPALAFLPGWLNGLLLDGLYTGFSTVAAFVPIIVLFFLVMSMV
EDSGYLSRAAFLMDTLMAKMGLDGRGFVMMLMGFGCNVPALMGTRVMRSRPMRLLTMLTI
PLSLCSARLQVFLFIIAILFPSSQAALVLFSLYLVSFATIFITAVLFKRSFQSREPFVLE
LPPYRFPTPQQIWMRGWQEVKHFLARATKFIVIGVVLVWLLTHLPFSATPASPETWAGSI
GRFFAPVLDPIGIDTQLAIALIFGFVAKEIVVGSLAVIYGLQGDALSQQIASNIDWVQGM
SFMLFTLIYTPCLSTIATLKSESKSSGFMWLSLAWSLMLAWLVSFAFYQTARALGY