Protein Info for GFF81 in Variovorax sp. SCN45

Annotation: Bll6900 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR04030: alkylhydroperoxidase domain protein, Avi_7169 family" amino acids 16 to 198 (183 residues), 291.6 bits, see alignment E=4.5e-91 TIGR01926: uncharacterized peroxidase-related enzyme" amino acids 28 to 199 (172 residues), 167.6 bits, see alignment E=3.6e-53 PF02627: CMD" amino acids 64 to 145 (82 residues), 44.2 bits, see alignment E=8e-16 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 84 to 118 (35 residues), 35.9 bits, see alignment 5.8e-13

Best Hits

KEGG orthology group: None (inferred from 78% identity to del:DelCs14_5470)

Predicted SEED Role

"Bll6900 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF81 Bll6900 protein (Variovorax sp. SCN45)
MSNRESTLIYPDNTHPTVFTQAQLEWLPWLEPLPEAELTERHFAGLVDAARAKSPYFRLL
ARDPDILGARTRTDKDIFYNPEAGLPRAERELSAAAASRYNGCIYCASVHARFASHFSHR
TEDVQRLLDEGTGAELGERWNTIVAASVALSSTPSAFGVEHIDQLRAQGLDDLAIADVIH
GAAFFNWANRLMLSLGEPQA