Protein Info for PS417_04105 in Pseudomonas simiae WCS417

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 186 to 186 (1 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 34 to 302 (269 residues), 201.3 bits, see alignment E=4e-63 PF00664: ABC_membrane" amino acids 42 to 321 (280 residues), 28.5 bits, see alignment E=2.5e-10 PF05992: SbmA_BacA" amino acids 43 to 351 (309 residues), 140.3 bits, see alignment E=2e-44 PF00005: ABC_tran" amino acids 388 to 521 (134 residues), 58 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 95% identity to pfs:PFLU0831)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA60 at UniProt or InterPro

Protein Sequence (574 amino acids)

>PS417_04105 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MNPNAEYSAVNDAVRGQFFRRTWAMITPYWRSEEKGKAWLLLAVVIGLSLFSVAISVWLN
HWYKDFYNALENKDTAAFWQQIGYFCGIATVAILGAVYRLYLTQMLTIRWRAWLTEKYFA
RWLGHKNYYQLEQGGYTDNPDQRISEDLNSFTSNTLSLGLGLLRNVVSLVSFSIILWGVS
GSIDVFGITIPGYMFWCALVYAAVGSWLTHLIGRRLIGLSNQQQRFEADLRFSMVRVREN
AESIALYNGEPNENQRLSARFGKVWHNYWDIMKVSKRLTFFTAGYEQIATVFAFIVAAPR
YFSGKIELGELMQINSAFGNVQGNFSWFISAYSDLAGWRATSDRLLSFQQAMRDNEQRPA
AIDVSAEGERLVVQGLGMDLVDGRHLLTDAHMIVEPGQRVMLSGRSGSGKSTLLRAMGHL
WPAGHGSIRLPAKRYLFLPQKPYLPIGTLKAVLSYPQDDSVYPAERYAQVLETCRLPHLV
GRLEEANHWQRMLSPGEQQRLAFARALLFAPQWLYMDEATSAMDEEDEATLYQALIDELP
GLSIVSVGHRSSLKRFHGRHVRIEGGRLQEQQLA