Protein Info for GFF808 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phage major tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16461: Phage_TTP_12
  • amino acids 18 to 152 (135 residues), 221 bits, E=6.8e-70
• PF08813: Phage_tail_3
  • amino acids 60 to 149 (90 residues), 24.7 bits, E=2.5e-09
• PF02368: Big_2
  • amino acids 162 to 236 (75 residues), 38.5 bits, E=1.4e-13

Best Hits

Swiss-Prot: 56% identical to TUBE_LAMBD: Tail tube protein (V) from Escherichia phage lambda

KEGG orthology group: None (inferred from 100% identity to stm:STM0916)

Predicted SEED Role

"Phage major tail protein"

Protein Sequence (247 amino acids)

>GFF808 Phage major tail protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGVPNPLIKTKGAGTTFWLYTGRGDAFHNPLADDDWLRLAGIKDLQPGEMTADAEDDDYL
DDEDADWKSTTQGQKSVGDTTATLAWKPGETGQKTLVDLFDSGEVRAFRIKYPNGTVDIF
RGWLSSLGKTITAKEVMTRTVKISGVGRPFLAEEDAPSVISVSGVTVAPLNASVAVGATT
TLTFTLKPDDATDKSLRIASSDTTLATVTQKDNVATVKGVKAGSVTVVGITTDGSLVAVA
PVTVTAP