Protein Info for GFF805 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR03438: dimethylhistidine N-methyltransferase" amino acids 23 to 330 (308 residues), 361 bits, see alignment E=2.4e-112 PF10017: Methyltransf_33" amino acids 24 to 331 (308 residues), 332.6 bits, see alignment E=1e-103

Best Hits

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF805 ABC transporter ATP-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRYIDQAPHFVQLHHPRPGATHPELIAGLLGTPARIAPKYFYDALGSRLFDAITELPEYY
PTRTEAAVFAQHGADMARHVPEGAVLVDLGAGSCAKAARLFPLLQPSAYVPVDISVDYLR
DTLASLQQRHADLPMLGLGMDFSTRFALGDDAITWLSERALAQQPRVVFYPGSSIGNFQP
DEALALLCQAHAVCEAGGAGGGLLIGVDRVKPRAVLEPAYDDALGVTAAFNRNLLRHVNR
LLDADFAPAAWQHVGLYNADESRIEMHLQSMGAQTVHWPGGERRFADGERLHTENSYKWA
PEDFETLLREAGFGAPRHWTDANGWFSVFWAPA