Protein Info for GFF804 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00347536: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 23 to 439 (417 residues), 521.6 bits, see alignment E=9.6e-161 PF12867: DinB_2" amino acids 27 to 157 (131 residues), 38.3 bits, see alignment E=1.7e-13 PF03781: FGE-sulfatase" amino acids 190 to 349 (160 residues), 75.2 bits, see alignment E=6.9e-25 amino acids 362 to 440 (79 residues), 42.6 bits, see alignment E=6.2e-15

Best Hits

Predicted SEED Role

"FIG00347536: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>GFF804 FIG00347536: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNPTPRPVDPQRSTDTLPNRAGLARHYTAVRERSRALAAPLSPEDCQAQSMPDASPTKWH
LAHVTWFFETFVLERFEPGFKAFDPAFRVLFNSYYQGVGEPFSRPQRGLLTRPDLATVWQ
WREQVDARIAHLIEHTGSDEALRLIELGLHHEQQHQELLLTDVKHLLSINPLRPVYQRHW
PLVPVTTVAPRWVEQPGGLVEVGHAGEGFAFDNELPRHRQWLEPHALMNRQVTHGEWWAF
VQDGGYTEPRWWLAAGWDWVRAQGLRAPLYWTLPPQASAALPTVFTLHGEAPLDPHTPVT
HISHFEADAFARWAAATHTEWQGARLPTEAEWEAAAAGLPVQGNLQEGGALHPLPARAAG
DGLLQMYGDVWEWTSSSYNAYPGYQPAEGAVGEYNGKFMVNQYVLRGGSCATPASHLRAS
YRNFFPTDARWQFSGLRLARSA