Protein Info for GFF803 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: PQQ-dependent oxidoreductase, gdhB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07995: GSDH" amino acids 40 to 372 (333 residues), 441.3 bits, see alignment E=1.3e-136

Best Hits

Swiss-Prot: 44% identical to YLII_ECOLI: Aldose sugar dehydrogenase YliI (yliI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 67% identity to mms:mma_0062)

MetaCyc: 44% identical to aldose sugar dehydrogenase YliI (Escherichia coli K-12 substr. MG1655)
1.1.5.-

Predicted SEED Role

"PQQ-dependent oxidoreductase, gdhB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF803 PQQ-dependent oxidoreductase, gdhB family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTRSFTAPLLPLFAAVGTLLAPAVHAQAPAVTTELVARGLHNPWAVAFIGEGRMLVTERP
GRMRVIGADGRVGEPLKGVPDVDAVGQGGLLDLVTDRDFARNRTVHFCYAEPGAMGMRNS
TALASARLSADARSLENVKVIFSQQPKVSSRLHFGCRIAQADDGSLFLALGDRYQRMADA
QTLDNHHGKVVRVRPDGRAHPDNPFVGRAGALPEIWSLGHRNVQGAALGPDGRLWTIEHG
PQGGDELNRTDAGKNYGWPVITYGENYGGGQIGDGLTSKDGMEQPLLYWKPSIAPSGMAF
VKGGPYGKDWQGNLLVGSLKFQYLVRLVMDGDRVVREEKLLPQLAQRVRDVRQGPDGFIY
LLTDDRDGQLLRLKPGS