Protein Info for PS417_04075 in Pseudomonas simiae WCS417

Annotation: peptide ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00496: SBP_bac_5" amino acids 72 to 452 (381 residues), 368.6 bits, see alignment E=1.9e-114

Best Hits

Swiss-Prot: 52% identical to DPPA_ECOLI: Periplasmic dipeptide transport protein (dppA) from Escherichia coli (strain K12)

KEGG orthology group: K12368, dipeptide transport system substrate-binding protein (inferred from 98% identity to pfs:PFLU0825)

MetaCyc: 52% identical to dipeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZL2 at UniProt or InterPro

Protein Sequence (534 amino acids)

>PS417_04075 peptide ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MRHTTVLSAMFATSLLAVATMGHAADKRSLVFCSEGSPAGFDTAQYTTATDNDAAEPLYN
RLVEFEKGETGVVPALATKWDISPDGMTYTFHLREGVKFHSNKEFKPTRDFNADDVLFTF
NRMLDPDHPFRKAYPTEFPYFNGMSLNKNIAKVEKTDPHTVVMTLNTVDAAFIQNIAMSF
AAILSAEYAEQLLKAGKPSDINQKPIGTGPFVFQRYQKDSQIRYVANKQYWDPSRVKLDQ
LIFAINTDASVRVQKLKAGECQVTLHPRPADVDALKADPNLKLLTKPGFNLGYIAYNVRH
KPFDQLEVRQALDMAVNKQSILNAVYQGAGQLAVNAMPPTQWSYDDSIKDAAYNPEKAKE
LLKAAGVKEGTEITLWAMPVQRPYNPNAKLMAEMLQSDWAKIGLKVKIVSYEWGEYIKRT
KNGEHDVSLIGWTGDNGDPDNWLGTLYSCDAIGGNNYSMWCDPAYDKLIKQAKVVTDREQ
RTVLYKQAQQLLKQQVPITPVAHSTVNQPLSAKVEGFKVSPFGRNVFSGVSITP