Protein Info for GFF80 in Sphingobium sp. HT1-2

Annotation: Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 27 to 182 (156 residues), 92.2 bits, see alignment E=3.7e-30 TIGR01191: heme exporter protein CcmC" amino acids 41 to 223 (183 residues), 214.5 bits, see alignment E=6e-68 PF27518: HelC" amino acids 197 to 235 (39 residues), 34.3 bits, see alignment 1.8e-12

Best Hits

KEGG orthology group: K02195, heme exporter protein C (inferred from 90% identity to sch:Sphch_0806)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF80 Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE (Sphingobium sp. HT1-2)
MHRFANPARFLKIARPMTGWLFWPGLVLLLAGCASGLFLTPADYLQGDTVRILYIHVPAA
WLGMAGWTGIAVSGLMQLVWRHPLASVAGRAIAAPGALFTAICLMTGSIWGRPTWGTWWE
WDGRMTSMLVLLFLYLGYIALANASARQGQGGVSPVTAIFGLVGAINIPIINRSVVWWNS
LHQGPSITMRGSSIDGSLLWPLGLTLFGFTLLFAAIVLMRMRAILAQNKVEARMQRLTRG