Protein Info for GFF795 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 49 to 72 (24 residues), see Phobius details amino acids 93 to 120 (28 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 318 to 348 (31 residues), see Phobius details amino acids 359 to 374 (16 residues), see Phobius details amino acids 379 to 393 (15 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF06808: DctM" amino acids 8 to 420 (413 residues), 373.8 bits, see alignment E=5.3e-116 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 425 (409 residues), 396.6 bits, see alignment E=5.4e-123

Best Hits

KEGG orthology group: None (inferred from 83% identity to pna:Pnap_1595)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>GFF795 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MELAVLSVTFLVLLLIGVPVAFSIGLASVATVLYAGVPVPIVFQKMVGGMQVFSFMAIPF
FVFAGELMLYGGIADRIVRFANSLVGHVRGGLGMSNVVGCTLFGGVAGSALADVSAMGSV
MIPLMKKEGYDADYAVNVTTHAALVGVLMPTSHNLIIFTLATTGIASVSVLNLILAAIVP
AVLLTVCNLAAAYYVAVKRGYPTRGKFPGWGEVLSAWLGALPGLLIVVIILVGILSGVFT
AAESAATAVLWALVVTVLVYRSLSWKDFLKACAKASKTTGVVLLLIGISSAFGYFMALYE
VPQKTGELMTSVSDNPWVIFLMINILLFILGTFLDMAATILVCTPIFLPIAMHFGMDPAQ
FGIVMLINCALGLNTPPVGVTQFVGCAIGGISVGQVMRSILPFYGALTVCLMLVTYVPAF
SLWLPSVFAK