Protein Info for GFF79 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), periplasmic substrate binding protein FhuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 83% identical to FHUD_ECOLI: Iron(3+)-hydroxamate-binding protein FhuD (fhuD) from Escherichia coli (strain K12)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 99% identity to sty:STY0220)

MetaCyc: 83% identical to iron(III) hydroxamate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), periplasmic substrate binding protein FhuD" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF79 Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), periplasmic substrate binding protein FhuD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRDLYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLPVELLLALGITPYGVA
DVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEKLARIAPGR
GFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIASQKPHFIRRGGRPLLMT
TLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAVSIDRLAMYKEADVICFDH
GNNTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLSTMHFVRILNNVLGGKA